PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G007500.1.p
Common NameH1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 380aa    MW: 42374.1 Da    PI: 6.5437
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G007500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-093033411755
                          HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          +  +k +yps++++  LA+++gL+++q+ +WF N+R ++
  Glyma.09G007500.1.p 303 NRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 341
                          4445689*****************************885 PP

2ELK40.75.1e-14261282122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          +LK qLlrKYsgyLgsLkqEF+
  Glyma.09G007500.1.p 261 DLKGQLLRKYSGYLGSLKQEFM 282
                          69*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.4E-20122166IPR005540KNOX1
PfamPF037902.1E-22123162IPR005540KNOX1
SMARTSM012561.2E-26175226IPR005541KNOX2
PfamPF037913.2E-21178225IPR005541KNOX2
PROSITE profilePS5121310.999261281IPR005539ELK domain
PfamPF037899.3E-11261282IPR005539ELK domain
SMARTSM011889.5E-8261282IPR005539ELK domain
PROSITE profilePS5007113.151281344IPR001356Homeobox domain
SMARTSM003894.6E-13283348IPR001356Homeobox domain
SuperFamilySSF466891.37E-19283359IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-28286346IPR009057Homeodomain-like
CDDcd000863.43E-13293345No hitNo description
PfamPF059207.9E-17301340IPR008422Homeobox KN domain
PROSITE patternPS000270319342IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MEGGSSSSNG TSYLLAFGEN NSGGLCPMTM MPLVTSHHAG HHPINPSNNN NVNTNCLFIP  60
NCSNSTGTPS IMLHNNHNNN KTDDDDNNNN TGLGYYFMES DHHHHHHGNN NNNGSSSSSS  120
SSAVKAKIMA HPHYHRLLAA YVNCQKVGAP PEVVARLEEA CASAATMAGG DAAAGSSCIG  180
EDPALDQFME AYCEMLTKYE QELSKPLKEA MLFLQRIECQ FKNLTISSSD FASNEGGDRN  240
GSSEEDVDLH NMIDPQAEDR DLKGQLLRKY SGYLGSLKQE FMKKRKKGKL PKEARQQLLE  300
WWNRHYKWPY PSESQKLALA ESTGLDQKQI NNWFINQRKR HWKPSEDMQF VVMDPSHPHY  360
YMDNVLGNPF PMDLSHPML*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1276285LKQEFMKKRK
2282286KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.77140.0flower| meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3105680.0
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed in the embryo proliferation stage, increases during early somatic embryo development and decreases thereafter.
UniprotTISSUE SPECIFICITY: Expressed mainly in embryonic tissues. Weakly detected in stems and hypocotyl.
Functional Description ? help Back to Top
Source Description
UniProtPossible transcription activator involved in early embryonic development. Probably binds to the DNA sequence 5'-TGAC-3'.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankSOYHOMEOGE0.0L13663.1 Glycine max homeobox-containing (Sbh1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001238058.10.0homeobox protein SBH1
SwissprotP466080.0HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0R0I1R80.0A0A0R0I1R8_SOYBN; Uncharacterized protein
STRINGGLYMA09G01000.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-131KNOX/ELK homeobox transcription factor
Publications ? help Back to Top
  1. Ma H,McMullen MD,Finer JJ
    Identification of a homeobox-containing gene with enhanced expression during soybean (Glycine max L.) somatic embryo development.
    Plant Mol. Biol., 1994. 24(3): p. 465-73
    [PMID:7907232]